Re: Repost - C# Discussion Boards

22-Jul-10 9:32

What is the exact code to write a fixed width text file in C#?
example:

instead of this:
IPLPPHPGHPGYINFSYEVLTPLKWYQSMMRHEYPSYGYEPMGGWLHHQIIPVLSQQHSPSHSLPPQHHIPI

I want:

IPLPPHPGHPG
YINFSYEVLTP
LKWYQSMMRHE
YPSYGYEPMGG
WLHHQIIPVLS
QQHSPSHSLPP
QHHIPI

Repost

Keith Barrow22-Jul-10 9:37

22-Jul-10 9:37

I gave you the algorithm.

Do not repost, its rude, and we will not do your homework assignments for you.

ragnaroknrol The Internet is For Porn[^]

Pete o'Hanlon: If it wasn't insulting tools, I'd say you were dumber than a bag of spanners.

Re: Repost

Iman Mohtashemi22-Jul-10 9:41

22-Jul-10 9:41

It is not a job nor a homework assignment so relax tool

Re: Repost

Keith Barrow22-Jul-10 10:05

Re: how to write s fixed width text file in C#?

22-Jul-10 10:05

Iman Mohtashemi wrote:
It is not a job nor a homework assignment so relax tool

Look, I can do this, in a far more efficent manner with shorter and clearer code you were given. I gave you the algorithm you needed, but it turns out you are either too stupid or too lazy to work out how to code it yourself.
Worse, when you weren't given the the code you wanted immediately you reposed with the standard "snd codez plz" response we get so much of here. It's not too much to posit you are in fact the tool in all this, at least I can code.

ragnaroknrol The Internet is For Porn[^]

Pete o'Hanlon: If it wasn't insulting tools, I'd say you were dumber than a bag of spanners.

harold aptroot22-Jul-10 9:37

harold aptroot

22-Jul-10 9:37

Are you kidding me? It's not even hard.

Re: how to write s fixed width text file in C#?

Luc Pattyn22-Jul-10 9:39

Luc Pattyn

22-Jul-10 9:39

that does not look like a fixed width at all, it is all jagged.

Dead | X|

Luc Pattyn [Forum Guidelines] [Why QA sucks] [My Articles] Nil Volentibus Arduum

Please use <PRE> tags for code snippets, they preserve indentation, and improve readability.

Re: how to write s fixed width text file in C#?

Pete O'Hanlon22-Jul-10 9:57

Pete O'Hanlon

22-Jul-10 9:57

The exact code has some letters, punctuation and some numbers. There, all you need to do is rearrange them into the correct sequence.

"WPF has many lovers. It's a veritable porn star!" - Josh Smith

As Braveheart once said, "You can take our freedom but you'll never take our Hobnobs!" - Martin Hughes.

My blog | My articles | MoXAML PowerToys | Onyx

fixed width text file

Iman Mohtashemi22-Jul-10 9:10

22-Jul-10 9:10

Hello,
How do I write a fixed width text file (say 80 characters per line) using the streamwriter in C#?
shekee

Keith Barrow22-Jul-10 9:18

22-Jul-10 9:18

Seeing as you asked a general question, here is a general answer:

Prepare the string for the current line. If it is too long, truncate and use the remainder for the next line. If it is too short, pad it with spaces. Repeat until you have written everything.

To write to a file you'll need System.IO, there is a TextWriter class in there that you can use.

ragnaroknrol The Internet is For Porn[^]

Pete o'Hanlon: If it wasn't insulting tools, I'd say you were dumber than a bag of spanners.

Iman Mohtashemi22-Jul-10 9:21

22-Jul-10 9:21

Sorry,
What is the exact code to write a fixed width text file in C#?
example:

instead of this:
IPLPPHPGHPGYINFSYEVLTPLKWYQSMMRHEYPSYGYEPMGGWLHHQIIPVLSQQHSPSHSLPPQHHIPI

I want:

IPLPPHPGHPG
YINFSYEVLTP
LKWYQSMMRHE
YPSYGYEPMGG
WLHHQIIPVLS
QQHSPSHSLPP
QHHIPI

Keith Barrow22-Jul-10 9:35

22-Jul-10 9:35

I gave you a basic algorithm to do exactly what you want (and information about file IO) , I'm not going to write the code for you, that is your job / assignment.
No-one is going to give you the code here, please read the FAQs and Sickies at the top of the forum.

ragnaroknrol The Internet is For Porn[^]

Pete o'Hanlon: If it wasn't insulting tools, I'd say you were dumber than a bag of spanners.

Samuel Cherinet22-Jul-10 9:38

Samuel Cherinet

22-Jul-10 9:38

Try this code ...

FileStream fs = new FileStream("<Full Path FileName>", FileMode.OpenOrCreate);
            StreamWriter sw = new StreamWriter(fs);
            string message = "<TextToWrite>";
            int charcount = 0;
            foreach(char ch in message)
            {
                sw.Write(ch);
                charcount++;
                if (charcount % 80 == 0)
                    sw.WriteLine();
            }
            sw.Close();

Iman Mohtashemi22-Jul-10 9:42